PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000120881
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 393aa    MW: 43320.8 Da    PI: 8.7305
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000120881genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.11.6e-53591861128
            NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk. 95 
                    lppGfrFhPtdeelvv+yLkkk+++ +l++ ++i+evd+yk++Pw+Lp+k++ +e+ewyfFs+rd+ky++g r+nra++sgyWkatg+dk+vls+ 
  MDP0000120881  59 LPPGFRFHPTDEELVVHYLKKKAASIPLPV-TIIAEVDLYKFDPWELPSKATFGEQEWYFFSPRDRKYPNGARPNRAATSGYWKATGTDKPVLSSi 153
                    79****************************.89***************8888999***************************************99 PP

            NAM  96 kgelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++vg+kk Lvfy g+ pkg+kt+W+mheyrl
  MDP0000120881 154 GNHKVGVKKALVFYGGKPPKGTKTNWIMHEYRL 186
                    9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-6550226IPR003441NAC domain
PROSITE profilePS5100561.29559226IPR003441NAC domain
PfamPF023654.7E-2860186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 393 aa     Download sequence    Send to blast
MADNSSSLTS PPPCKFVVPD PHVSPNHCVE NPHVGRSPVP RRILMESTNS SSGSQHPQLP  60
PGFRFHPTDE ELVVHYLKKK AASIPLPVTI IAEVDLYKFD PWELPSKATF GEQEWYFFSP  120
RDRKYPNGAR PNRAATSGYW KATGTDKPVL SSIGNHKVGV KKALVFYGGK PPKGTKTNWI  180
MHEYRLVNNT TTTINMSSST TKPSDAANKK PSLRLDDWVL CRIYKKNKGP VMSIDGDHFL  240
HKAEDSNSSM EEGMFLHPSI LPTQKLPPLP PPPSSKLPTT DYTALLESDD HESYLEGILS  300
SSDHQPGSHS HDHDQFGTIS TSISKSSLPL KRHLPSPFWN DVGSIGTAAA TTTSSSKKFH  360
ADLINENNSF VSMLNQTPQG TAPFHANAAL LER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A1e-735922717166NO APICAL MERISTEM PROTEIN
1ut4_B1e-735922717166NO APICAL MERISTEM PROTEIN
1ut7_A1e-735922717166NO APICAL MERISTEM PROTEIN
1ut7_B1e-735922717166NO APICAL MERISTEM PROTEIN
3swm_A1e-735922720169NAC domain-containing protein 19
3swm_B1e-735922720169NAC domain-containing protein 19
3swm_C1e-735922720169NAC domain-containing protein 19
3swm_D1e-735922720169NAC domain-containing protein 19
3swp_A1e-735922720169NAC domain-containing protein 19
3swp_B1e-735922720169NAC domain-containing protein 19
3swp_C1e-735922720169NAC domain-containing protein 19
3swp_D1e-735922720169NAC domain-containing protein 19
4dul_A1e-735922717166NAC domain-containing protein 19
4dul_B1e-735922717166NAC domain-containing protein 19
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.15790.0cell culture| fruit
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF1981240.0KF198124.1 Malus hupehensis NAC domain protein (NAC92) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001280970.10.0NAC transcription factor 25-like
SwissprotQ8GY424e-98NAC25_ARATH; NAC transcription factor 25
TrEMBLS5R9620.0S5R962_9R
STRINGPOPTR_0011s04650.11e-128(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16233498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G61110.12e-94NAC domain containing protein 25